PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g030910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 735aa    MW: 81994.4 Da    PI: 5.7468
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g030910.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-18105159256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++ +++t +q++e+e++Fe+++yps+++r +L++ lgLt  qVk+WFqN+R++ +
  Csa11g030910.1 105 SRYHRHTVHQIQEMEAVFEETSYPSENKRLRLSEGLGLTPLQVKFWFQNKRTQIR 159
                     567889*********************************************9876 PP

2START115.11e-362574862206
                     HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGG.CT-TT-SEEEEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddke.qWdetlakaetlev 84 
                     la ++ qel+ + +++ep+W+k +  +n+ ++l ++e +k            ++ ea+ra++vv m++++lv+ +ld     +   + +a++++v
  Csa11g030910.1 257 LAVSCCQELIIMCDVNEPLWTKKR-LDNESVCLNEEEYKKMflwppmddddrFRREASRAKAVVMMNSMTLVKAFLDAWSeLFCPIVSSAKLIQV 350
                     788999******************.6777777777777666999999999999************************98889999999******* PP

                     ECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.......-TTSEE-EESSEEEEEEEECTCEEEEEE CS
           START  85 issg.....galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe......sssvvRaellpSgiliepksnghskvtw 166
                     iss      g l lm+a lq+ spl p R+ +f+Ry ++  ++ +w+ivd  ++s +   +      +  +   ++ pSg++i++++ng+s+vtw
  Csa11g030910.1 351 ISSKvsgtnGSLLLMYAGLQVVSPLLPtREGYFLRYLERkAKKVKWIIVDFPIESFRGFVKpastaaTTTIGLYRRKPSGCIIQEMANGYSEVTW 445
                     ***9999********************************888889*****99987654332223455444444559******************* PP

                     EE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 167 vehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     vehv++++++  +++++  vksg+a+ga +w+a l+rqce+
  Csa11g030910.1 446 VEHVEVEEKQEqDEVVKEYVKSGVAFGAERWLAVLKRQCER 486
                     **********999**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-1787162IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-1899165IPR009057Homeodomain-like
PROSITE profilePS5007116.228101161IPR001356Homeobox domain
SMARTSM003892.9E-16102165IPR001356Homeobox domain
CDDcd000861.71E-14104162No hitNo description
PfamPF000463.9E-16106159IPR001356Homeobox domain
PROSITE patternPS000270136159IPR017970Homeobox, conserved site
PROSITE profilePS5084835.287247489IPR002913START domain
SuperFamilySSF559612.06E-20248488No hitNo description
CDDcd088756.17E-90251485No hitNo description
SMARTSM002341.9E-19256486IPR002913START domain
PfamPF018527.7E-29257486IPR002913START domain
SuperFamilySSF559618.1E-9507693No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
METKDKTVMY GDYQVMKSSE DVSYSDSDKI FGSTSSSSPT ATIQNPNLKF TAFDNLNFPY  60
MTPKEEEYGV MSMIGSGSGV STGSGHHYLV ETTAIEEESS AAKKSRYHRH TVHQIQEMEA  120
VFEETSYPSE NKRLRLSEGL GLTPLQVKFW FQNKRTQIRA QQDRRANVML KAENDTLKIE  180
SQELQSSSQC LSCSSCGNNL RLENTRLRQE LDQLRRIVSM RVDPPPPSQE IACFFPETDN  240
NDDVLIAEEE KAIAMELAVS CCQELIIMCD VNEPLWTKKR LDNESVCLNE EEYKKMFLWP  300
PMDDDDRFRR EASRAKAVVM MNSMTLVKAF LDAWSELFCP IVSSAKLIQV ISSKVSGTNG  360
SLLLMYAGLQ VVSPLLPTRE GYFLRYLERK AKKVKWIIVD FPIESFRGFV KPASTAATTT  420
IGLYRRKPSG CIIQEMANGY SEVTWVEHVE VEEKQEQDEV VKEYVKSGVA FGAERWLAVL  480
KRQCERMASL MATNITDLGV IPSVAARKNL MKLSQRMVKT FCLNISNSYG QASTKDTVRI  540
VTRTVSDGFV PCAVSVTYLP YSHHKVFDLL RDNQRLSQLE ILFNGSSFQE VAHIANGSHP  600
GNNTSLLRIN MESNTWHNVE LMLQETCTDD SGSLLVFSTV DADAFQLAMN GKDPSNIPLL  660
PVGFSVVPVN PSDGVKGTSV NLPSCFLTVA IQVLVKNTSG ADAKLDLSTV SAINNRICAT  720
VNRITSALVN DVSN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010439959.10.0PREDICTED: homeobox-leucine zipper protein HDG4-like isoform X3
SwissprotQ8L7H40.0HDG4_ARATH; Homeobox-leucine zipper protein HDG4
TrEMBLR0GP440.0R0GP44_9BRAS; Uncharacterized protein
STRINGAT4G17710.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43562548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17710.10.0homeodomain GLABROUS 4